PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000466G0340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family M-type_MADS
Protein Properties Length: 370aa    MW: 41214.6 Da    PI: 6.6431
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000466G0340genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF689.2e-221053245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     + en+  rqvt+skRr gi+KKA+ELS+LCd++  +++fs+tgk
  PH01000466G0340 10 KLENSNGRQVTYSKRRSGIMKKAKELSILCDIDLILLMFSPTGK 53
                     679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.558153IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-30160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-26295IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.5E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRVKLKIKK LENSNGRQVT YSKRRSGIMK KAKELSILCD IDLILLMFSP TGKPTICIGD  60
RSNIEEVIAK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEELSSH  120
LGALQCQMAD VQKRLSYWSE PEKVENIDHI RAMEQSLKES LNRIRIHKEN FAKQHLMGLQ  180
CAAAQFQNDM KLPLGLIGDP NASSWFHNGG GEGQQPMMLP EDPSLLHQRD IGCSTSTSLQ  240
SYPGYFSMSK QSTDTGGEHQ QPELSSAECL TSLHPCAQFP YQSAFDHASL LNDRLFRPDM  300
ELQDNAAAAM DFSGHYDLPR PGDEAGFQNW ASAACGATMY DHQQQPPSAR PLIQTMTESL  360
TISSLQQQL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3731110.0AK373111.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3021H04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618004.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X3
RefseqXP_015618002.10.0PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
SwissprotQ1PFA44e-87AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLW5EQ680.0W5EQ68_WHEAT; Uncharacterized protein
TrEMBLM8BZ660.0M8BZ66_AEGTA; MADS-box transcription factor 2
TrEMBLW5DR980.0W5DR98_WHEAT; Uncharacterized protein
STRINGMLOC_11474.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.23e-77AGAMOUS-like 30